Mol Scientific
- Home
- Companies
- Mol Scientific
- Products
- Mol Scientific - Model MPE0011679 - ...
Mol Scientific - Model MPE0011679 - Beta-Amyloid (1-49)
FromMol Scientific
Mol Scientific offer high-quality Beta-Amyloid (1-49) product(MPE0011679). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches
Brand: Mol Scientific
Product Name: Beta-Amyloid (1-49)
Cat #: MPE0011679
Molecular Formula:C239H376N62O69S
Molecular Weight:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
Three letter code:Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-Val-Ile-Val-Ile-Thr-Leu
Peptide Purity (HPLC):>95%; 98% and 99% purity available upon request
Quantity/Unit:1 Vial