InnoPep Inc.
- Home
- Companies
- InnoPep Inc.
- Products
- Model 1631-005 - Growth Hormone ...
Model 1631-005 - Growth Hormone Releasing Factor, GRF (1 - 29), Amide, Human
FromInnoPep Inc.
This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding.
Most popular related searches
- Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
- Sequence (3 Letter): H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
- Molecular Weight: 3357.9
- Properties
- Purity: > 95% By HPLC
- Storage: Store at -20 °C, cap vial tightly at all times.