Mol Scientific
  1. Companies
  2. Mol Scientific
  3. Products
  4. Mol Scientific - Model MPE0009778 - ...

Mol ScientificModel MPE0009778 -Hemoglobin alpha chain [034-065] peptide

SHARE
Mol Scientific offer high-quality Hemoglobin alpha chain [034-065] peptide product(MPE0009778). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches

Brand: Mol Scientific
Product Name: Hemoglobin alpha chain [034-065] peptide
Cat #: MPE0009778
Molecular Formula:
Molecular Weight:LSFPTTKTYFPHFDLSHGSAQVKGHGAKVAAA
Three letter code:Leu-Ser-Phe-Pro-Thr-Thr-Lys-Thr-Tyr-Phe-Pro-His-Phe-Asp-Leu-Ser-His-Gly-Ser-Ala-Gln-Val-Lys-Gly-His-Gly-Ala-Lys-Val-Ala-Ala-Ala
Peptide Purity (HPLC):
Quantity/Unit:1 Vial