Mol Scientific -Model MPE0009804 -Hemoglobin alpha chain [107-141] peptide
FromMol Scientific
Mol Scientific offer high-quality Hemoglobin alpha chain [107-141] peptide product(MPE0009804). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches
Brand: Mol Scientific
Product Name: Hemoglobin alpha chain [107-141] peptide
Cat #: MPE0009804
Molecular Formula:
Molecular Weight:VTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR
Three letter code:Val-Thr-Leu-Ala-Ser-His-Leu-Pro-Ser-Asp-Phe-Thr-Pro-Ala-Val-His-Ala-Ser-Leu-Asp-Lys-Phe-Leu-Ala-Asn-Val-Ser-Thr-Val-Leu-Thr-Ser-Lys-Tyr-Arg
Peptide Purity (HPLC):
Quantity/Unit:1 Vial