Mol Scientific
  1. Companies
  2. Mol Scientific
  3. Products
  4. Mol Scientific - Model MPE0006361 - ...

Mol ScientificModel MPE0006361 -Growth hormone-relasing hormone related peptide, GHRH-RP

SHARE
Mol Scientific offer high-quality Growth hormone-relasing hormone related peptide, GHRH-RP product(MPE0006361). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches

Brand: Mol Scientific
Product Name: Growth hormone-relasing hormone related peptide, GHRH-RP
Cat #: MPE0006361
Molecular Formula:C153H245N43O45S2
Molecular Weight:HLDRVWAEDKQMALESILQGFPRMKLSAEA
Three letter code:H-His-Leu-Asp-Arg-Val-Trp-Ala-Glu-Asp-Lys-Gln-Met-Ala-Leu-Glu-Ser-Ile-Leu-Gln-Gly-Phe-Pro-Arg-Met-Lys-Leu-Ser-Ala-Glu-Ala-OH
Peptide Purity (HPLC):
Quantity/Unit:1 Vial

About Us 
Mol Scientific is a national high-tech enterprise, committed to providing high quality products and services for our customers. Our products and services are mainly applied in molecular biology, cell biology, immunology, and biomedical fields.
 
Who We Are?
Mol Scientific is an evolving custom service provider, offering one-stop services for protein and antibody discovery, research, development, and production. As a reliable partner for researchers in basic life sciences and early-stage biomedical development, our high-quality research and development teams of Mol Scientific specialize in the research and development of high-quality biological agents such as genes, peptides, proteins, antibodies, diagnostic reagents, etc., striving to bring our esteemed customers the finest services at highly competitive prices.
We offer highly customized solutions with a combination of expertise, capabilities, flexibility and quality, which perfectly suit to a diversity of needs.
 
Contact Us
For quote, please fill in the online form or email to  info@mol-scientific.com