Mol Scientific
  1. Companies
  2. Mol Scientific
  3. Products
  4. Mol Scientific - Model MPE0006152 - ...

Mol ScientificModel MPE0006152 - Pancreatic polypeptide 1

SHARE
Mol Scientific offer high-quality Pancreatic polypeptide 1 product(MPE0006152). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches

Brand: Mol Scientific
Product Name: Pancreatic polypeptide 1
Cat #: MPE0006152
Molecular Formula:C201H282N50O57S
Molecular Weight:APSEPMHPGDQASPEQLAKYYDDWWQYITFITRPRF
Three letter code:H-Ala-Pro-Ser-Glu-Pro-Met-His-Pro-Gly-Asp-Gln-Ala-Ser-Pro-Glu-Gln-Leu-Ala-Lys-Tyr-Tyr-Asp-Asp-Trp-Trp-Gln-Tyr-Ile-Thr-Phe-Ile-Thr-Arg-Pro-Arg-Phe-OH
Peptide Purity (HPLC):
Quantity/Unit:1 Vial