Mol Scientific -Model MPE0011716 -Pancreatic Polypeptide, human

SHARE
Mol Scientific offer high-quality Pancreatic Polypeptide, human product(MPE0011716). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches

Brand: Mol Scientific
Product Name: Pancreatic Polypeptide, human
Cat #: MPE0011716
Molecular Formula:C185H287N53O54S2
Molecular Weight:APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY
Three letter code:Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2
Peptide Purity (HPLC):>95%; 98% and 99% purity available upon request
Quantity/Unit:1 Vial