Mol Scientific
- Home
- Companies
- Mol Scientific
- Products
- Mol Scientific - Model MPE0011734 - ...
Mol Scientific - Model MPE0011734 - Prepro-Atrial Natriuretic Factor (26-55) (human)
FromMol Scientific
Mol Scientific offer high-quality Prepro-Atrial Natriuretic Factor (26-55) (human) product(MPE0011734). Mol Scientific committed to bring our esteemed customers high quality products and the finest services at highly competitive prices.
Most popular related searches
Brand: Mol Scientific
Product Name: Prepro-Atrial Natriuretic Factor (26-55) (human)
Cat #: MPE0011734
Molecular Formula:C152H236N38O51S3
Molecular Weight:NPMYNAVSNADLMDFKNLLDHLEEKMPLED
Three letter code:Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp
Peptide Purity (HPLC):>95%; 98% and 99% purity available upon request
Quantity/Unit:1 Vial